PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_003052-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 257aa    MW: 29992.3 Da    PI: 9.1458
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_003052-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding67.22.9e-211360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llv++v+++G g+W++++r+ g++R++k+c++rw +yl
  AHYPO_003052-RA 13 KGPWTPEEDKLLVEYVNLHGEGRWSSVSRCAGLNRSGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding50.83.9e-1666110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++  +G++ W+tIar+++ gRt++++k++w+++
  AHYPO_003052-RA  66 RGQITPQEEGIIIELHSIWGNK-WSTIARYLP-GRTDNEIKNYWRTH 110
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.051864IPR017930Myb domain
SuperFamilySSF466891.83E-3210107IPR009057Homeodomain-like
SMARTSM007173.3E-181262IPR001005SANT/Myb domain
PfamPF002491.1E-191360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241467IPR009057Homeodomain-like
CDDcd001671.04E-121560No hitNo description
SMARTSM007179.3E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129420.28465115IPR017930Myb domain
PfamPF002499.2E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2468114IPR009057Homeodomain-like
CDDcd001674.64E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGVWAVQNQG WRKGPWTPEE DKLLVEYVNL HGEGRWSSVS RCAGLNRSGK SCRLRWVNYL  60
RPGLKRGQIT PQEEGIIIEL HSIWGNKWST IARYLPGRTD NEIKNYWRTH FKKKERSRKV  120
SKSQKLKPKA PKEEPIIDQP TQVQTQEQDN NQVVPSQDHT FNNNNNNNNN KQEVMFMHPN  180
NIIEEQNLMM ITTPSWIDST CHDQDGSWWG SLWNFGDLMQ QDNNNQYCSK MALSLQNQAN  240
YNTTNNNTPN INNTNNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25131147107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3740872e-34DQ374087.1 Beta vulgaris chromosome 9 clone BAC33 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666760.17e-97PREDICTED: transcription factor MYB82
TrEMBLQ20CC12e-86Q20CC1_BETVU; Fgenesh protein 125
STRINGAT3G30210.13e-76(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.12e-71myb domain protein 121